TA341808 REL antibody

Rabbit Polyclonal Anti-Rel Antibody

See related secondary antibodies

Search for all "REL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat REL

TA341808

Product Description for REL

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat REL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for REL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-Rel proto-oncogene protein, c-Rel
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q04864
Immunogen:
The immunogen for anti-Rel antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF.
GeneID:
5966
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for REL (1 products)

Catalog No. Species Pres. Purity   Source  

REL

REL Human
  Abnova Taiwan Corp.

Positive controls for REL (1 products)

Catalog No. Species Pres. Purity   Source  

REL overexpression lysate

REL overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn