TA341814 SIN3B antibody

Rabbit Polyclonal Anti-Sin3b Antibody

See related secondary antibodies

Search for all "SIN3B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rat SIN3B

Product Description for SIN3B

Rabbit anti Mouse, Rat SIN3B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SIN3B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Histone deacetylase complex subunit Sin3b, KIAA0700, Paired amphipathic helix protein Sin3b, Transcriptional corepressor Sin3b
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q62141
Immunogen:
The immunogen for anti-Sin3b antibody: synthetic peptide directed towards the N terminal of mouse Sin3b. Synthetic peptide located within the following region: LSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPV.
GeneID:
20467
Application WB
Background Sin3B is one ofThe Sin3 co-repressors act as a protein scaffold to recruit transcription factors via its four highly homologous paired amphipathic helix (PAH) domains.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn