TA341815 TAL2 antibody

Rabbit Polyclonal Anti-Tal2 Antibody

See related secondary antibodies

Search for all "TAL2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat TAL2

Product Description for TAL2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat TAL2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TAL2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms T-cell acute lymphocytic leukemia protein 2, TAL-2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16559
Immunogen:
The immunogen for anti-Tal2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS.
GeneID:
6887
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TAL2 (1 products)

Catalog No. Species Pres. Purity   Source  

TAL2

TAL2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TAL2 (1 products)

Catalog No. Species Pres. Purity   Source  

TAL2 overexpression lysate

TAL2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn