TA341819 TFAM / TCF6 antibody

Rabbit Polyclonal Anti-TFAM Antibody

See related secondary antibodies

Search for all "TFAM / TCF6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rabbit, Rat TFAM / TCF6

Product Description for TFAM / TCF6

Rabbit anti Mouse, Rabbit, Rat TFAM / TCF6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TFAM / TCF6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Mitochondrial transcription factor 1, MtTF1, TCF-6, TCF6L2, Transcription factor 6, Transcription factor 6-like 2, mitochondrial Transcription factor A
Presentation Purified
Reactivity Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P40630
Immunogen:
The immunogen for anti-TFAM antibody: synthetic peptide directed towards the middle region of mouse TFAM. Synthetic peptide located within the following region: SESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMK.
GeneID:
21780
Application WB
Background TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated thatThis protein is required to regulateThe mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression ofThe gene was elimited by targeted disruption in heart and muscle cells.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn