TA341822 THRB / ERBA2 antibody

Rabbit Polyclonal Anti-Thrb Antibody

See related secondary antibodies

Search for all "THRB / ERBA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rat THRB / ERBA2

TA341822

More Views

  • TA341822
  • TA341822

Product Description for THRB / ERBA2

Rabbit anti Mouse, Rat THRB / ERBA2.
Presentation: Purified
Product is tested for ChIP assay, Western blot / Immunoblot.

Properties for THRB / ERBA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NR1A2, Nuclear receptor subfamily 1 group A member 2, THR1, Thyroid hormone receptor beta
Presentation Purified
Reactivity Ms, Rt
Applications ChIP, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P37242
Immunogen:
The immunogen for anti-Thrb antibody: synthetic peptide directed towards the n terminal of mouse Thrb. Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY.
GeneID:
21834
Application WB
ChIP
Background Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn