TA341825 VAX1 antibody

Rabbit Polyclonal Anti-Vax1 Antibody

See related secondary antibodies

Search for all "VAX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish VAX1

Product Description for VAX1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish VAX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for VAX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ventral anterior homeobox 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SQQ9
Immunogen:
The immunogen for anti-Vax1 antibody: synthetic peptide directed towards the middle region of mouse Vax1. Synthetic peptide located within the following region: RERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCS.
GeneID:
11023
Application WB
Background Vax1 is required for axon guidance and major tract formation inThe developing forebrain. It may contribute toThe differentiation ofThe neuroreti, pigmented epithelium and optic stalk.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for VAX1 (3 products)

Catalog No. Species Pres. Purity   Source  

VAX1 (transcript variant 2)

VAX1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

VAX1

VAX1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

VAX1

VAX1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for VAX1 (3 products)

Catalog No. Species Pres. Purity   Source  

VAX1 Lysate

Western Blot: VAX1 Lysate [NBL1-17703] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VAX1
  Novus Biologicals Inc.

VAX1 overexpression lysate

VAX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

VAX1 overexpression lysate

VAX1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn