TA341832 Ah receptor repressor / AhRR antibody

Rabbit Polyclonal Anti-Ahrr Antibody

See related secondary antibodies

Search for all "Ah receptor repressor / AhRR"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse, Rat Ah receptor repressor / AhRR

Product Description for Ah receptor repressor / AhRR

Rabbit anti Mouse, Rat Ah receptor repressor / AhRR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Ah receptor repressor / AhRR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AhR repressor, Aryl hydrocarbon receptor repressor, BHLHE77, KIAA1234
Presentation Purified
Reactivity Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3U1U7
Immunogen:
The immunogen for anti-Ahrr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CLRGGPDLLDPKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPV.
GeneID:
11624
Application WB
Background Ahrr mediates dioxin toxicity and is involved in regulation of cell growth and differentiation. Ahrr repressesThe transcription activity of AHR by competing withThis transcription factor for heterodimer formation withThe ARNT and subsequently binding toThe xenobiotic response element (XRE) sequence present inThe promoter regulatory region of variety of genes. Ahrr represses CYP1A1 by bindingThe XRE sequence and recruiting ANKRA2, HDAC4 and/or HDAC5. Autoregulates its expression by associating with its own XRE site.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn