TA341848 CORIN antibody

Rabbit Polyclonal Anti-CORIN Antibody

See related secondary antibodies

Search for all "CORIN"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CORIN

Product Description for CORIN

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CORIN.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CORIN

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATC2, Atrial natriuretic peptide-converting enzyme, CRN, Heart-specific serine proteinase ATC2, Pro-ANP-converting enzyme, TMPRSS10, Transmembrane protease serine 10
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5Q5
Immunogen:
The immunogen for anti-CORIN antibody: synthetic peptide directed towards the C terminal of human CORIN. Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG.
GeneID:
10699
Application WB
Background This gene encodes a member ofThe type II transmembrane serine protease class ofThe trypsin superfamily. Members ofThis family are composed of multiple structurally distinct domains.The encoded protein converts pro-atrial triuretic peptide to biologically active atrial triuretic peptide, a cardiac hormone that regulates blood volume and pressure.This protein may also function as a pro-brain-type triuretic peptide convertase. Multiple altertively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2013].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CORIN (3 products)

Catalog No. Species Pres. Purity   Source  

CORIN

CORIN Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

CORIN

CORIN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CORIN

CORIN Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn