TA341850 KLRA1 antibody

Rabbit Polyclonal Anti-KLRA1 Antibody

See related secondary antibodies

Search for all "KLRA1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat KLRA1

Product Description for KLRA1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat KLRA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KLRA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KLRA-1, Killer cell lectin-like receptor subfamily A, LY49A, LY49L, Lymphocyte antigen 49a, T lymphocyte antigen A1, member 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NSY2
Immunogen:
The immunogen for anti-KLRA1 antibody: synthetic peptide directed towards the N terminal of human KLRA1. Synthetic peptide located within the following region: NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL.
GeneID:
10748
Application WB
Background The function ofThe KLRA1 protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KLRA1 (4 products)

Catalog No. Species Pres. Purity   Source  

KLRA1

KLRA1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KLRA1

KLRA1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KLRA1

KLRA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KLRA1

KLRA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KLRA1 (1 products)

Catalog No. Species Pres. Purity   Source  

KLRA1 Lysate

Western Blot: KLRA1 Lysate [NBL1-12360] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for KLRA1.
  Novus Biologicals Inc.
  • LinkedIn