TA341859 SC4MOL antibody

Rabbit Polyclonal Anti-SC4MOL Antibody

See related secondary antibodies

Search for all "SC4MOL"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SC4MOL

Product Description for SC4MOL

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SC4MOL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SC4MOL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-4 methylsterol oxidase, DESP4, ERG25, Methylsterol monooxygenase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15800
Immunogen:
The immunogen for anti-SC4MOL antibody: synthetic peptide directed towards the N terminal of human SC4MOL. Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA.
GeneID:
6307
Application WB
Background Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity toThe yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.The protein is localized toThe endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Altertively spliced transcript variants encoding distinct isoforms have been found forThis gene. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SC4MOL (2 products)

Catalog No. Species Pres. Purity   Source  

SC4MOL

SC4MOL Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SC4MOL

SC4MOL Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SC4MOL (1 products)

Catalog No. Species Pres. Purity   Source  

MSMO1 overexpression lysate

MSMO1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn