TA341861 AFG3L2 antibody

Rabbit Polyclonal Anti-AFG3L2 Antibody

See related secondary antibodies

Search for all "AFG3L2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish AFG3L2

TA341861

Product Description for AFG3L2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish AFG3L2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AFG3L2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AFG3-like protein 2, Paraplegin-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y4W6
Immunogen:
The immunogen for anti-AFG3L2 antibody: synthetic peptide directed towards the middle region of human AFG3L2. Synthetic peptide located within the following region: VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS.
GeneID:
10939
Application WB
Background This gene encodes a protein localized in mitochondria and closely related to paraplegin.The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia.This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AFG3L2 (2 products)

Catalog No. Species Pres. Purity   Source  

AFG3L2

AFG3L2 Human Purified
  Abnova Taiwan Corp.

AFG3L2

AFG3L2 Human Purified
  Abnova Taiwan Corp.

Positive controls for AFG3L2 (2 products)

Catalog No. Species Pres. Purity   Source  

AFG3L2 293T Cell Transient Overexpression Lysate(Denatured)

AFG3L2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

AFG3L2 Lysate

Western Blot: AFG3L2 Lysate [NBL1-07374] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AFG3L2 Protein
  Novus Biologicals Inc.
  • LinkedIn