TA341869 B3GNT1 / B3GNT6 antibody

Rabbit Polyclonal Anti-B3gnt1 Antibody

See related secondary antibodies

Search for all "B3GNT1 / B3GNT6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat B3GNT1 / B3GNT6

Product Description for B3GNT1 / B3GNT6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat B3GNT1 / B3GNT6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for B3GNT1 / B3GNT6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-N-acetylglucosaminyltransferase, 3-N-acetylglucosaminyltransferase, 3-N-acetylglucosaminyltransferase 1, I-beta-1, N-acetyllactosaminide beta-1, Poly-N-acetyllactosamine extension enzym, UDP-GlcNAc:betaGal beta-1, iGnT
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8BWP8
Immunogen:
The immunogen for Anti-B3gnt1 antibody is: synthetic peptide directed towards the middle region of Mouse B3gnt1. Synthetic peptide located within the following region: RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL.
GeneID:
108902
Application WB
Background Can initiateThe synthesis orThe elongation ofThe linear poly-N-acetyllactosaminoglycans. Involved in alpha-dystroglycan (DAG1) glycosylation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn