TA341870 ST3GAL2 antibody

Rabbit Polyclonal Anti-ST3GAL2 Antibody

See related secondary antibodies

Search for all "ST3GAL2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ST3GAL2

Product Description for ST3GAL2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ST3GAL2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ST3GAL2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-GalNAc-alpha-2, 3-ST 2, 3-sialyltransferase, 3-sialyltransferase 2, Alpha 2, Beta-galactoside alpha-2, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2, Gal-NAc6S, Gal-beta-1, SIAT4-B, SIAT4B, ST3Gal II, ST3GalA.2, ST3GalII, Sialyltransferase 4B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16842
Immunogen:
The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2. Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN.
GeneID:
6483
Application WB
Background The protein encoded byThis gene is a type II membrane protein that catalyzesThe transfer of sialic acid from CMP-sialic acid to galactose-containing substrates.The encoded protein is normally found inThe Golgi but can be proteolytically processed to a soluble form.This protein, which is a member of glycosyltransferase family 29, can useThe same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ST3GAL2 (5 products)

Catalog No. Species Pres. Purity   Source  

ST3GAL2

ST3GAL2 Human in vitro transl.
  Abnova Taiwan Corp.

ST3GAL2

ST3GAL2 Human in vitro transl.
  Abnova Taiwan Corp.

ST3GAL2

ST3GAL2 Human in vitro transl.
  Abnova Taiwan Corp.

ST3GAL2

ST3GAL2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ST3GAL2

ST3GAL2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ST3GAL2 (1 products)

Catalog No. Species Pres. Purity   Source  

ST3GAL2 293T Cell Transient Overexpression Lysate(Denatured)

ST3GAL2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn