TA341885 GALNT6 antibody

Rabbit Polyclonal Anti-GALNT6 Antibody

See related secondary antibodies

Search for all "GALNT6"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GALNT6

TA341885

More Views

  • TA341885

Product Description for GALNT6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GALNT6.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GALNT6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GalNAc transferase 6, GalNAc-T6, Polypeptide N-acetylgalactosaminyltransferase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6, pp-GaNTase 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCL4
Immunogen:
The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the N terminal of human GALNT6. Synthetic peptide located within the following region: MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP.
GeneID:
11226
Application WB
IHC
Background This gene encodes a member ofThe UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (Galc-T) family of enzymes. Galc-Ts initiate mucin-type O-linked glycosylation inThe Golgi apparatus by catalyzingThe transfer of Galc to serine and threonine residues on target proteins.They are characterized by an N-termil transmembrane domain, a stem region, a lumel catalytic domain containing a GT1 motif and Gal/Galc transferase motif, and a C-termil ricin/lectin-like domain. Galc-Ts have different, but overlapping, substrate specificities and patterns of expression.The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved inThe synthesis of oncofetal fibronectin. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GALNT6 (6 products)

Catalog No. Species Pres. Purity   Source  

GALNT6

GALNT6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GALNT6

GALNT6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GALNT6

GALNT6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GALNT6

GALNT6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GALNT6

GALNT6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GALNT6

GALNT6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GALNT6 (4 products)

Catalog No. Species Pres. Purity   Source  

GALNT6 293T Cell Transient Overexpression Lysate(Denatured)

GALNT6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GALNT6 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

GALNT6 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-GALNT6 antibody (H00011226-M01) by Western Blots.
  Abnova Taiwan Corp.

GALNT6 Lysate

Western Blot: GALNT6 Lysate [NBL1-10957] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GALNT6
  Novus Biologicals Inc.

GALNT6 overexpression lysate

GALNT6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn