Home » CHIC2

TA341896 CHIC2 antibody

Rabbit Polyclonal Anti-CHIC2 Antibody

Search for all "CHIC2"

0.1 ml / €360.00

Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CHIC2

More Views

Product Description for CHIC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CHIC2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CHIC2

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	BTL, BrX-like translocated in leukemia, Cysteine-rich hydrophobic domain 2 protein
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications	P, WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: Q9UKJ5 Immunogen: The immunogen for anti-CHIC2 antibody: synthetic peptide directed towards the N terminal of human CHIC2. Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI. GeneID: 26511
Application	WB IHC
Background	This gene encodes a member ofThe CHIC family of proteins.The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures andThe plasma membrane.This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008].
Format	Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CHIC2 (5 products)

Catalog No.	Species	Purity	Source
TP304420	CHIC2
	Human	> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
				OriGene Technologies, Inc.
H00026511-P01-10	CHIC2
	Human	12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
				Abnova Taiwan Corp.
H00026511-P01-25	CHIC2
	Human	12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
				Abnova Taiwan Corp.
H00026511-Q01-10	CHIC2
	Human	12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
				Abnova Taiwan Corp.
H00026511-Q01-25	CHIC2
	Human	12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
				Abnova Taiwan Corp.

Positive controls for CHIC2 (2 products)

Catalog No.	Species
NBL1-09154	CHIC2 Lysate

		Novus Biologicals Inc.
LY415979	CHIC2 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Recommended Secondary Antibodies for CHIC2 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH

Click here to see all secondary antibodies for CHIC2

Antibodies (see all»)

Kits (see all»)

Antigens

Lysates (see all»)