TA341902 C20orf103 antibody

Rabbit Polyclonal Anti-C20orf103 Antibody

See related secondary antibodies

Search for all "C20orf103"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish C20orf103

TA341902

More Views

  • TA341902

Product Description for C20orf103

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish C20orf103.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C20orf103

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LAMP family protein C20orf103
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJQ1
Immunogen:
The immunogen for anti-C20orf103 antibody: synthetic peptide directed towards the middle region of human C20orf103. Synthetic peptide located within the following region: CQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDERE.
GeneID:
24141
Application WB
Background The exact function of C20orf103 remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf103 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf103

C20orf103 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C20orf103 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf103 Lysate

Western Blot: C20orf103 Lysate [NBL1-08354] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C20orf103 Protein
  Novus Biologicals Inc.
  • LinkedIn