TA341903 TRAM2 antibody

Rabbit Polyclonal Anti-TRAM2 Antibody

See related secondary antibodies

Search for all "TRAM2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRAM2

Product Description for TRAM2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRAM2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRAM2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0057, Translocating chain-associated membrane protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15035
Immunogen:
The immunogen for anti-TRAM2 antibody: synthetic peptide directed towards the N terminal of human TRAM2. Synthetic peptide located within the following region: MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII.
GeneID:
9697
Application WB
Background TRAM2 is a component ofThe translocon, a gated macromolecular channel that controlsThe posttranslatiol processing of scent secretory and membrane proteins atThe endoplasmic reticulum (ER) membrane.[supplied by OMIM, Jul 2004]. ##Evidence-Data-START## Transcript exon combition :: BC028121.1, D31762.1 [ECO:0000332] Rseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRAM2 (4 products)

Catalog No. Species Pres. Purity   Source  

TRAM2

TRAM2 Human Purified
  Abnova Taiwan Corp.

TRAM2

TRAM2 Human Purified
  Abnova Taiwan Corp.

TRAM2

TRAM2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRAM2

TRAM2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRAM2 (1 products)

Catalog No. Species Pres. Purity   Source  

TRAM2 Lysate

Western Blot: TRAM2 Lysate [NBL1-17254] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRAM2
  Novus Biologicals Inc.
  • LinkedIn