TA341906 DNAJB9 antibody

Rabbit Polyclonal Anti-DNAJB9 Antibody

See related secondary antibodies

Search for all "DNAJB9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish DNAJB9

Product Description for DNAJB9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish DNAJB9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNAJB9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNAJB9, DnaJ homolog subfamily B member 9, MDG1, UNQ743/PRO1471
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBS3
Immunogen:
The immunogen for anti-DNAJB9 antibody: synthetic peptide directed towards the N terminal of human DNAJB9. Synthetic peptide located within the following region: MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA.
GeneID:
4189
Application WB
Background This gene is a member ofThe J protein family. J proteins function in many cellular processes by regulatingThe ATPase activity of 70 kDa heat shock proteins.This gene is a member ofThe type 2 subgroup of DJ proteins.The encoded protein is localized toThe endoplasmic reticulum.This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJB9 (5 products)

Catalog No. Species Pres. Purity   Source  

DNAJB9 (full length, N-term HIS tag)

DNAJB9 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

DNAJB9

DNAJB9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DNAJB9

DNAJB9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DNAJB9

DNAJB9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DNAJB9

DNAJB9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DNAJB9 (1 products)

Catalog No. Species Pres. Purity   Source  

MDG1 Lysate

Western Blot: MDG1 Lysate [NBL1-09943] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DNAJB9
  Novus Biologicals Inc.
  • LinkedIn