TA341908 Tetraspanin-12 (TSPAN12) antibody

Rabbit Polyclonal Anti-TSPAN12 Antibody

See related secondary antibodies

Search for all "Tetraspanin-12 (TSPAN12)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Tetraspanin-12 (TSPAN12)

Product Description for Tetraspanin-12 (TSPAN12)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Tetraspanin-12 (TSPAN12).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tetraspanin-12 (TSPAN12)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NET2, TM4SF12, Tetraspan NET-2, Transmembrane 4 superfamily member 12, Tspan-12
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95859
Immunogen:
The immunogen for anti-TSPAN12 antibody: synthetic peptide directed towards the middle region of human TSPAN12. Synthetic peptide located within the following region: DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI.
GeneID:
23554
Application WB
Background The protein encoded byThis gene is a member ofThe transmembrane 4 superfamily, also known asThe tetraspanin family. Most ofThese members are cell-surface proteins that are characterized byThe presence of four hydrophobic domains.The proteins mediate sigl transduction events that play a role inThe regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Tetraspanin-12 (TSPAN12) (1 products)

Catalog No. Species Pres. Purity   Source  

Tetraspanin-12 (TSPAN12)

Tetraspanin-12 (TSPAN12) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn