TA341913 Neuroplastin / SDFR1 antibody

Rabbit Polyclonal Anti-NPTN Antibody

See related secondary antibodies

Search for all "Neuroplastin / SDFR1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Neuroplastin / SDFR1

TA341913

More Views

  • TA341913

Product Description for Neuroplastin / SDFR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Neuroplastin / SDFR1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Neuroplastin / SDFR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NPTN, SDR-1, SDR1, Stromal cell-derived receptor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y639-2
Immunogen:
The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN.
GeneID:
27020
Application WB
IHC
Background This gene encodes a type I transmembrane protein belonging toThe Ig superfamily.The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Altertive splicing results in multiple transcript variants. [provided by RefSeq, May 2009].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn