TA341914 Synaptogyrin-4 / SYNGR4 antibody

Rabbit Polyclonal Anti-SYNGR4 Antibody

See related secondary antibodies

Search for all "Synaptogyrin-4 / SYNGR4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat Synaptogyrin-4 / SYNGR4

Product Description for Synaptogyrin-4 / SYNGR4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat Synaptogyrin-4 / SYNGR4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Synaptogyrin-4 / SYNGR4

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95473
Immunogen:
The immunogen for anti-SYNGR4 antibody: synthetic peptide directed towards the N terminal of human SYNGR4. Synthetic peptide located within the following region: MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM.
GeneID:
23546
Application WB
Background This gene encodes an integral membrane protein.The gene belongs toThe syptogyrin gene family. Like other members ofThe familyThe protein contains four transmembrane regions.The exact function ofThis protein is unclear. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Synaptogyrin-4 / SYNGR4 (1 products)

Catalog No. Species Pres. Purity   Source  

SYNGR4 overexpression lysate

SYNGR4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn