TA341921 ST6GALNAC6 antibody

Rabbit Polyclonal Anti-ST6GALNAC6 Antibody

See related secondary antibodies

Search for all "ST6GALNAC6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ST6GALNAC6

Product Description for ST6GALNAC6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ST6GALNAC6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ST6GALNAC6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 6-sialyltransferase 6, 6-sialyltransferase VI, Alpha-N-acetylgalactosaminide alpha-2, GalNAc alpha-2, SIAT7-F, SIAT7F, ST6GalNAc VI, ST6GalNAcVI, Sialyltransferase 7F
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969X2
Immunogen:
The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC6. Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP.
GeneID:
30815
Application WB
Background ST6GALC6 belongs to a family of sialyltransferases that modify proteins and ceramides onThe cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).[supplied by OMIM, Mar 2008]. Transcript Variant:This variant (5) differs inThe 5' UTR, lacks a portion ofThe 5' coding region, and initiates translation from a downstream in-frame start codon, compared to variant 1.The encoded isoform (c) is shorter atThe N-terminus, compared to isoform a. Variants 3, 4 and 5 all encode isoform c. ##Evidence-Data-START## Transcript exon combition :: AK057100.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ST6GALNAC6 (8 products)

Catalog No. Species Pres. Purity   Source  

ST6GALNAC6

ST6GALNAC6 Human in vitro transl.
  Abnova Taiwan Corp.

ST6GALNAC6

ST6GALNAC6 Human in vitro transl.
  Abnova Taiwan Corp.

ST6GALNAC6

ST6GALNAC6 Human in vitro transl.
  Abnova Taiwan Corp.

ST6GALNAC6

ST6GALNAC6 Human Purified
  Abnova Taiwan Corp.

ST6GALNAC6

ST6GALNAC6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ST6GALNAC6

ST6GALNAC6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ST6GALNAC6

ST6GALNAC6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ST6GALNAC6

ST6GALNAC6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ST6GALNAC6 (2 products)

Catalog No. Species Pres. Purity   Source  

ST6GALNAC6 293T Cell Transient Overexpression Lysate(Denatured)

ST6GALNAC6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ST6GALNAC6 293T Cell Transient Overexpression Lysate(Denatured)

ST6GALNAC6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn