TA341929 C9orf4 antibody

Rabbit Polyclonal Anti-C9orf4 Antibody

See related secondary antibodies

Search for all "C9orf4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish C9orf4

Product Description for C9orf4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish C9orf4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C9orf4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brain protein CG-6, Uncharacterized protein C9orf4, chromosome 9 open reading frame 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P0K9
Immunogen:
The immunogen for anti-C9orf4 antibody: synthetic peptide directed towards the middle region of human C9orf4. Synthetic peptide located within the following region: HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP.
GeneID:
23732
Application WB
Background The exact function of C9orf4 remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C9orf4 (2 products)

Catalog No. Species Pres. Purity   Source  

C9orf4

C9orf4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

C9orf4

C9orf4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for C9orf4 (1 products)

Catalog No. Species Pres. Purity   Source  

FRRS1L overexpression lysate

FRRS1L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn