TA341933 FJX1 antibody

Rabbit Polyclonal Anti-FJX1 Antibody

See related secondary antibodies

Search for all "FJX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rat FJX1

Product Description for FJX1

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rat FJX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FJX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Four-jointed box protein 1, Four-jointed protein homolog
Presentation Purified
Reactivity Can, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86VR8
Immunogen:
The immunogen for anti-FJX1 antibody: synthetic peptide directed towards the N terminal of human FJX1. Synthetic peptide located within the following region: MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG.
GeneID:
24147
Application WB
Background The protein encoded byThis gene isThe human ortholog of mouse and Drosophila four-jointed gene product.The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development ofThe eyes.The exact function ofThis gene in humans is not known. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FJX1 (2 products)

Catalog No. Species Pres. Purity   Source  

FJX1

FJX1 Human Purified
  Abnova Taiwan Corp.

FJX1

FJX1 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn