TA341956 Seladin-1 / DHCR24 antibody

Rabbit Polyclonal Anti-DHCR24 Antibody

See related secondary antibodies

Search for all "Seladin-1 / DHCR24"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Seladin-1 / DHCR24

Product Description for Seladin-1 / DHCR24

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Seladin-1 / DHCR24.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Seladin-1 / DHCR24

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 24-dehydrocholesterol reductase, 3-beta-hydroxysterol delta-24-reductase, Diminuto/dwarf1 homolog, KIAA0018
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15392
Immunogen:
The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the middle region of human DHCR24. Synthetic peptide located within the following region: AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE.
GeneID:
1718
Application WB
Background This gene encodes a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzesThe reduction ofThe delta-24 double bond of sterol intermediates during cholesterol biosynthesis.The protein contains a leader sequence that directs it toThe endoplasmic reticulum membrane. Missense mutations inThis gene have been associated with desmosterolosis. Also, reduced expression ofThe gene occurs inThe temporal cortex of Alzheimer disease patients and overexpression has been observed in adrel gland cancer cells. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Seladin-1 / DHCR24 (4 products)

Catalog No. Species Pres. Purity   Source  

Seladin-1 / DHCR24

Seladin-1 / DHCR24 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Seladin-1 / DHCR24

Seladin-1 / DHCR24 Human
  Abnova Taiwan Corp.

Seladin-1 / DHCR24

Seladin-1 / DHCR24 Human Purified
  Abnova Taiwan Corp.

Seladin-1 / DHCR24

Seladin-1 / DHCR24 Human Purified
  Abnova Taiwan Corp.

Positive controls for Seladin-1 / DHCR24 (2 products)

Catalog No. Species Pres. Purity   Source  

DHCR24 293T Cell Transient Overexpression Lysate(Denatured)

DHCR24 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Seladin 1 Lysate

Western Blot: Seladin 1 Lysate [NBL1-09857] - Western Blot experiments. Left-Control; Right -Over-expression Lysate for DHCR24.
  Novus Biologicals Inc.
  • LinkedIn