TA341957 KIAA0494 antibody

Rabbit Polyclonal Anti-4732418C07Rik Antibody

See related secondary antibodies

Search for all "KIAA0494"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KIAA0494

Product Description for KIAA0494

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KIAA0494.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA0494

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EF-hand domain-containing protein KIAA0494
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75071
Immunogen:
The immunogen for Anti-4732418C07Rik antibody is: synthetic peptide directed towards the C-terminal region of 4732418C07Rik. Synthetic peptide located within the following region: ISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPL.
GeneID:
9813
Application WB
Background The function ofThis protein remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA0494 (3 products)

Catalog No. Species Pres. Purity   Source  

KIAA0494

KIAA0494 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KIAA0494

KIAA0494 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KIAA0494

KIAA0494 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KIAA0494 (3 products)

Catalog No. Species Pres. Purity   Source  

EFCAB14 overexpression lysate

EFCAB14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

KIAA0494 293T Cell Transient Overexpression Lysate(Denatured)

KIAA0494 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

KIAA0494 Lysate

Western Blot: KIAA0494 Lysate [NBL1-12248] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KIAA0494
  Novus Biologicals Inc.
  • LinkedIn