TA341962 KIAA0319 antibody

Rabbit Polyclonal Anti-KIAA0319 Antibody

See related secondary antibodies

Search for all "KIAA0319"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat KIAA0319

TA341962

More Views

  • TA341962

Product Description for KIAA0319

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat KIAA0319.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KIAA0319

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VV43
Immunogen:
The immunogen for anti-KIAA0319 antibody: synthetic peptide directed towards the N terminal of human KIAA0319. Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG.
GeneID:
9856
Application WB
IHC
Background This gene encodes a transmembrane protein that contains a large extracellular domain with multiple polycystic kidney disease (PKD) domains.The encoded protein may play a role inThe development ofThe cerebral cortex by regulating neurol migration and cell adhesion. Single nucleotide polymorphisms inThis gene are associated with dyslexia. Altertively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Nov 2011].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA0319 (1 products)

Catalog No. Species Pres. Purity   Source  

KIAA0319

KIAA0319 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.
  • LinkedIn