TA341963 SV2B antibody

Rabbit Polyclonal Anti-SV2B Antibody

See related secondary antibodies

Search for all "SV2B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SV2B

Product Description for SV2B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SV2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SV2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0735, Synaptic vesicle glycoprotein 2B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L1I2
Immunogen:
The immunogen for Anti-SV2B antibody is: synthetic peptide directed towards the C-terminal region of Human SV2B. Synthetic peptide located within the following region: TINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTY.
GeneID:
9899
Application WB
Background Probably plays a role inThe control of regulated secretion in neural and endocrine cells.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SV2B (4 products)

Catalog No. Species Pres. Purity   Source  

SV2B

SV2B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SV2B

SV2B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SV2B

SV2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SV2B

SV2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SV2B (3 products)

Catalog No. Species Pres. Purity   Source  

SV2B 293T Cell Transient Overexpression Lysate(Denatured)

SV2B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SV2B Lysate

Western Blot: SV2B Lysate [NBL1-16631] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SV2B
  Novus Biologicals Inc.

SV2B overexpression lysate

SV2B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn