TA341966 Adenylate cyclase type 6 antibody

Rabbit Polyclonal Anti-ADCY6 Antibody

See related secondary antibodies

Search for all "Adenylate cyclase type 6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Adenylate cyclase type 6

TA341966

Product Description for Adenylate cyclase type 6

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Adenylate cyclase type 6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Adenylate cyclase type 6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADCY6, ATP pyrophosphate-lyase 6, Adenylate cyclase type VI, Adenylyl cyclase 6, KIAA0422
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43306
Immunogen:
The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY.
GeneID:
112
Application WB
Background This gene encodes adenylate cyclase 6, which is a membrane-associated enzyme and catalyzesThe formation ofThe secondary messenger cyclic adenosine monophosphate (cAMP).The expression ofThis gene is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue. Altertive splicing generates 2 transcript variants. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Adenylate cyclase type 6 (2 products)

Catalog No. Species Pres. Purity   Source  

Adenylate cyclase type 6

Adenylate cyclase type 6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Adenylate cyclase type 6

Adenylate cyclase type 6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn