TA341995 IER3IP1 antibody

Rabbit Polyclonal Anti-Hdhd2 Antibody

See related secondary antibodies

Search for all "IER3IP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish IER3IP1

TA341995

Product Description for IER3IP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish IER3IP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IER3IP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Immediate early response 3-interacting protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5U9
Immunogen:
The immunogen for Anti-Hdhd2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hdhd2. Synthetic peptide located within the following region: LMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIR.
GeneID:
51124
Application WB
Background The function ofThis protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn