TA342002 SDF4 / CAB45 antibody

Rabbit Polyclonal Anti-SDF4 Antibody

See related secondary antibodies

Search for all "SDF4 / CAB45"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rat, Zebrafish SDF4 / CAB45

Product Description for SDF4 / CAB45

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rat, Zebrafish SDF4 / CAB45.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SDF4 / CAB45

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 45 kDa calcium-binding protein, PSEC0034, SDF-4, Stromal cell-derived factor 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRK5
Immunogen:
The immunogen for anti-SDF4 antibody: synthetic peptide directed towards the C terminal of human SDF4. Synthetic peptide located within the following region: KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA.
GeneID:
51150
Application WB
Background This gene encodes a stromal cell derived factor that is a member ofThe CREC protein family.The encoded protein contains six EF-hand motifs and calcium-binding motifs.This protein localizes toThe Golgi lumen and may be involved in regulating calcium dependent cellular activities. [provided by RefSeq, Sep 2011].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SDF4 / CAB45 (2 products)

Catalog No. Species Pres. Purity   Source  

SDF4 / CAB45

SDF4 / CAB45 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

SDF4 / CAB45

SDF4 / CAB45 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.
  • LinkedIn