TA342006 ACSL5 antibody

Rabbit Polyclonal Anti-ACSL5 Antibody

See related secondary antibodies

Search for all "ACSL5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ACSL5

TA342006

More Views

  • TA342006

Product Description for ACSL5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ACSL5.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ACSL5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ACS5, FACL5, LACS5, Long-chain acyl-CoA synthetase 5, Long-chain-fatty-acid--CoA ligase 5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULC5
Immunogen:
The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG.
GeneID:
51703
Application WB
IHC
Background The protein encoded byThis gene is an isozyme ofThe long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes ofThis family convert free long-chain fatty acids into fatty acyl-CoA esters, andThereby play a key role in lipid biosynthesis and fatty acid degradation.This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignt gliomas.This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ACSL5 (6 products)

Catalog No. Species Pres. Purity   Source  

ACSL5 (transcript variant 2)

ACSL5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ACSL5 (transcript variant 3)

ACSL5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ACSL5

ACSL5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACSL5

ACSL5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACSL5

ACSL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACSL5

ACSL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ACSL5 (5 products)

Catalog No. Species Pres. Purity   Source  

ACSL5 293T Cell Transient Overexpression Lysate(Denatured)

ACSL5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ACSL5 Lysate

Western Blot: ACSL5 Lysate [NBL1-07266] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACSL5 Protein
  Novus Biologicals Inc.

ACSL5 overexpression lysate

ACSL5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ACSL5 overexpression lysate

ACSL5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ACSL5 overexpression lysate

ACSL5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn