TA342012 TMEM9 antibody

Rabbit Polyclonal Anti-TMEM9 Antibody

See related secondary antibodies

Search for all "TMEM9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMEM9

Product Description for TMEM9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMEM9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DERP4, Dermal papilla-derived protein 4, Transmembrane protein 9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P0T7
Immunogen:
The immunogen for anti-TMEM9 antibody: synthetic peptide directed towards the C terminal of human TMEM9. Synthetic peptide located within the following region: DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS.
GeneID:
252839
Application WB
Background May be involved in intracellular transport.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM9 (2 products)

Catalog No. Species Pres. Purity   Source  

TMEM9

TMEM9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMEM9

TMEM9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TMEM9 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM9 Lysate

Western Blot: TMEM9 Lysate [NBL1-17109] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TMEM9
  Novus Biologicals Inc.
  • LinkedIn