TA342017 CEND1 antibody

Rabbit Polyclonal Anti-CEND1 Antibody

See related secondary antibodies

Search for all "CEND1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat CEND1

Product Description for CEND1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat CEND1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CEND1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BM88, Cell cycle exit and neuronal differentiation protein 1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N111
Immunogen:
The immunogen for anti-CEND1 antibody: synthetic peptide directed towards the N terminal of human CEND1. Synthetic peptide located within the following region: MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ.
GeneID:
51286
Application WB
Background The protein encoded byThis gene is a neuron-specific protein.The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neurol differentiation in vivo. Multiple pseudogenes have been reported forThis gene. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CEND1 (3 products)

Catalog No. Species Pres. Purity   Source  

CEND1

CEND1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CEND1 (1-125, His-tag)

CEND1 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

CEND1 (1-125, His-tag)

CEND1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Positive controls for CEND1 (1 products)

Catalog No. Species Pres. Purity   Source  

CEND1 overexpression lysate

CEND1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn