TA342047 TMCO3 antibody

Rabbit Polyclonal Anti-TMCO3 Antibody

See related secondary antibodies

Search for all "TMCO3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TMCO3

Product Description for TMCO3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TMCO3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMCO3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C13orf11, Transmembrane and coiled-coil domain-containing protein 3, UNQ2419/PRO4976, UNQ2419/PRO4976
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWJ1
Immunogen:
The immunogen for anti-TMCO3 antibody: synthetic peptide directed towards the N terminal of human TMCO3. Synthetic peptide located within the following region: KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL.
GeneID:
55002
Application WB
Background Probable (+)/H(+) antiporter.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn