TA342051 SIGLEC10 antibody

Rabbit Polyclonal Anti-SIGLEC10 Antibody

See related secondary antibodies

Search for all "SIGLEC10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human SIGLEC10

Product Description for SIGLEC10

Rabbit anti Canine, Human SIGLEC10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SIGLEC10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SLG2, Sialic acid-binding Ig-like lectin 10, Siglec-10, Siglec-like protein 2
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96LC7
Immunogen:
The immunogen for anti-SIGLEC10 antibody: synthetic peptide directed towards the middle region of human SIGLEC10. Synthetic peptide located within the following region: CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL.
GeneID:
89790
Application WB
Background SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid.The sialic acid recognition site may be masked by cis interactions with sialic acids onThe same cell surface. InThe immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) viaTheir SH2 domain(s) that block sigl transduction through dephosphorylation of sigling molecules.SIGLECs are members ofThe immunoglobulin superfamily that are expressed onThe cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells ofThe inte immune system, withThe exception ofThe B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-653 AC008750.9 90495-91147 c 654-760 DA387605.1 391-497 761-2959 AF301007.1 262-2460 2960-3794 AY358337.1 1930-2764
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SIGLEC10 (2 products)

Catalog No. Species Pres. Purity   Source  

SIGLEC10

SIGLEC10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SIGLEC10

SIGLEC10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SIGLEC10 (3 products)

Catalog No. Species Pres. Purity   Source  

SIGLEC10 Lysate

Western Blot: SIGLEC10 Lysate [NBL1-15957] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for SIGLEC10.
  Novus Biologicals Inc.

SIGLEC10 overexpression lysate

SIGLEC10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SIGLEC10 overexpression lysate

SIGLEC10 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn