TA342063 CNTNAP3 antibody

Rabbit Polyclonal Anti-CNTNAP3 Antibody

See related secondary antibodies

Search for all "CNTNAP3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CNTNAP3

Product Description for CNTNAP3

Rabbit anti Human CNTNAP3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CNTNAP3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CASPR3, Cell recognition molecule Caspr3, Contactin-associated protein-like 3, KIAA1714
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZ76
Immunogen:
The immunogen for anti-CNTNAP3 antibody: synthetic peptide directed towards the middle region of human CNTNAP3. Synthetic peptide located within the following region: GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA.
GeneID:
79937
Application WB
Background The specific function ofThis protein remains unknown.The protein encoded byThis gene belongs toThe NCP family of cell-recognition molecules.This family represents a distinct subgroup ofThe neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.The protein encoded byThis gene may play a role in cell recognition withinThe nervous system. Altertively spliced transcript variants encoding different isoforms have been described butTheir biological ture has not been determined.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn