TA342070 SLITRK1 antibody

Rabbit Polyclonal Anti-SLITRK1 Antibody

See related secondary antibodies

Search for all "SLITRK1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLITRK1

Product Description for SLITRK1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLITRK1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLITRK1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1910, LRRC12, Leucine-rich repeat-containing protein 12, SLIT and NTRK-like protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PX8
Immunogen:
The immunogen for anti-SLITRK1 antibody: synthetic peptide directed towards the N terminal of human SLITRK1. Synthetic peptide located within the following region: CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV.
GeneID:
114798
Application WB
Background Members ofThe SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-termil leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, but not SLITRK1, also have C-termil regions that share homology with neurotrophin receptors. SLITRKs are expressed predomintly in neural tissues and have neurite-modulating activity.Members ofThe SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-termil leucine-rich repeat (LRR) domains similar to those of SLIT proteins (see SLIT1; MIM 603742). Most SLITRKs, but not SLITRK1, also have C-termil regions that share homology with neurotrophin receptors (see NTRK1; MIM 191315). SLITRKs are expressed predomintly in neural tissues and have neurite-modulating activity (Aruga et al., 2003 [PubMed 14557068]).[supplied by OMIM]. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additiol publications.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn