TA342075 CD352 / SLAMF6 antibody

Rabbit Polyclonal Anti-SLAMF6 Antibody

See related secondary antibodies

Search for all "CD352 / SLAMF6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CD352 / SLAMF6

Product Description for CD352 / SLAMF6

Rabbit anti Human CD352 / SLAMF6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD352 / SLAMF6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Activating NK receptor, KALI, LY108, NK-T-B-antigen, NTB-A
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DU3
Immunogen:
The immunogen for anti-SLAMF6 antibody: synthetic peptide directed towards the N terminal of human SLAMF6. Synthetic peptide located within the following region: EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT.
GeneID:
114836
Application WB
Background SLAMF6 is a type I transmembrane protein, belonging toThe CD2 subfamily ofThe immunoglobulin superfamily. SLAMF6 is expressed on tural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates withThe Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor inThe process of NK cell activation. It can also mediate inhibitory sigls in NK cells from X-linked lymphoproliferative patients.The protein encoded byThis gene is a type I transmembrane protein, belonging toThe CD2 subfamily ofThe immunoglobulin superfamily.This encoded protein is expressed on tural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates withThe Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor inThe process of NK cell activation. It can also mediate inhibitory sigls in NK cells from X-linked lymphoproliferative patients. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additiol publications.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD352 / SLAMF6 (5 products)

Catalog No. Species Pres. Purity   Source  

CD352 / SLAMF6 (transcript variant 3)

CD352 / SLAMF6 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CD352 / SLAMF6 (transcript variant 2)

CD352 / SLAMF6 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

CD352 / SLAMF6 (22-226, His-tag)

CD352 / SLAMF6 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

CD352 / SLAMF6 (22-226, His-tag)

CD352 / SLAMF6 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

CD352 / SLAMF6

CD352 / SLAMF6 Human
  Abnova Taiwan Corp.

Positive controls for CD352 / SLAMF6 (2 products)

Catalog No. Species Pres. Purity   Source  

SLAMF6 overexpression lysate

SLAMF6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SLAMF6 overexpression lysate

SLAMF6 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn