TA342076 TMEM123 / Porimin antibody

Rabbit Polyclonal Anti-TMEM123 Antibody

See related secondary antibodies

Search for all "TMEM123 / Porimin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TMEM123 / Porimin

Product Description for TMEM123 / Porimin

Rabbit anti Human TMEM123 / Porimin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM123 / Porimin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KCT-3, KCT3, Keratinocytes-associated transmembrane protein 3, PSEC0111, Pro-oncosis receptor inducing membrane injury, Transmembrane protein 123
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N131
Immunogen:
The immunogen for anti-TMEM123 antibody: synthetic peptide directed towards the C terminal of human TMEM123. Synthetic peptide located within the following region: SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG.
GeneID:
114908
Application WB
Background TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinksThis protein onThe cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without D fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.This gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinksThis protein onThe cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without D fragmentation.This gene product is proposed to function as a cell surface receptor that mediates cell death.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM123 / Porimin (4 products)

Catalog No. Species Pres. Purity   Source  

TMEM123 / Porimin

TMEM123 / Porimin Human Purified
  Abnova Taiwan Corp.

TMEM123 / Porimin

TMEM123 / Porimin Human Purified
  Abnova Taiwan Corp.

TMEM123 / Porimin

TMEM123 / Porimin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TMEM123 / Porimin

TMEM123 / Porimin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TMEM123 / Porimin (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM123 293T Cell Transient Overexpression Lysate(Denatured)

TMEM123 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn