TA342084 Aquaporin-10 / AQP10 antibody

Rabbit Polyclonal Anti-AQP10 Antibody

See related secondary antibodies

Search for all "Aquaporin-10 / AQP10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Rabbit, Rat Aquaporin-10 / AQP10

Product Description for Aquaporin-10 / AQP10

Rabbit anti Bovine, Human, Rabbit, Rat Aquaporin-10 / AQP10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Aquaporin-10 / AQP10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AQP-10, Small intestine aquaporin
Presentation Purified
Reactivity Bov, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PS8
Immunogen:
The immunogen for anti-AQP10 antibody: synthetic peptide directed towards the C terminal of human AQP10. Synthetic peptide located within the following region: VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK.
GeneID:
89872
Application WB
Background AQP10 is a member ofThe aquaglyceroporin family of integral membrane proteins. Members ofThis family function as water-permeable channels inThe epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.This gene encodes a member ofThe aquaglyceroporin family of integral membrane proteins. Members ofThis family function as water-permeable channels inThe epithelia of organs that absorb and excrete water.This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Aquaporin-10 / AQP10 (2 products)

Catalog No. Species Pres. Purity   Source  

AQP10 Lysate

Western Blot: AQP10 Lysate [NBL1-07636] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AQP10 Protein
  Novus Biologicals Inc.

AQP10 overexpression lysate

AQP10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn