TA342097 Intelectin-2 / ITLN2 antibody

Rabbit Polyclonal Anti-ITLN2 Antibody

See related secondary antibodies

Search for all "Intelectin-2 / ITLN2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep Intelectin-2 / ITLN2

Product Description for Intelectin-2 / ITLN2

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep Intelectin-2 / ITLN2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Intelectin-2 / ITLN2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Endothelial lectin HL-2
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WWU7
Immunogen:
The immunogen for anti-ITLN2 antibody: synthetic peptide directed towards the middle region of human ITLN2. Synthetic peptide located within the following region: TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA.
GeneID:
142683
Application WB
Background ITLN2 may play a role inThe defense system against pathogens.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Intelectin-2 / ITLN2 (1 products)

Catalog No. Species Pres. Purity   Source  

ITLN2 overexpression lysate

ITLN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn