TA342108 ZNF782 antibody

Rabbit Polyclonal Anti-ZNF782 Antibody

See related secondary antibodies

Search for all "ZNF782"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human ZNF782

Product Description for ZNF782

Rabbit anti Canine, Human ZNF782.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF782

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZMW2
Immunogen:
The immunogen for anti-ZNF782 antibody: synthetic peptide directed towards the N terminal of human ZNF782. Synthetic peptide located within the following region: TNKLLTTEQEISGKPHNRDINIFRARMMPCKCDIAGSACQGLSLMAPHCQ.
GeneID:
158431
Application WB
Background ZNF782 may be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn