TA342122 ZNF121 antibody

Rabbit Polyclonal Anti-ZNF121 Antibody

See related secondary antibodies

Search for all "ZNF121"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat ZNF121

Product Description for ZNF121

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat ZNF121.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF121

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZNF20, Zinc finger protein 121, Zinc finger protein 20
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P58317
Immunogen:
The immunogen for anti-ZNF121 antibody: synthetic peptide directed towards the middle region of human ZNF121. Synthetic peptide located within the following region: LTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKS.
GeneID:
7675
Application WB
Background ZNF121 belongs toThe krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers. ZNF121 may be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn