TA342124 PHF19 / PCL3 antibody

Rabbit Polyclonal Anti-PHF19 Antibody

See related secondary antibodies

Search for all "PHF19 / PCL3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PHF19 / PCL3

TA342124

More Views

  • TA342124
  • TA342124

Product Description for PHF19 / PCL3

Rabbit anti Human PHF19 / PCL3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PHF19 / PCL3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PHD finger protein 19, Polycomb-like protein 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T6S3-2
Immunogen:
The immunogen for anti-PHF19 antibody: synthetic peptide directed towards the C terminal of human PHF19. Synthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET.
GeneID:
26147
Application WB
Background PHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpiol repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn