TA342154 PRKY antibody

Rabbit polyclonal Anti-PRKY Antibody

See related secondary antibodies

Search for all "PRKY"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PRKY

Product Description for PRKY

Rabbit anti Human PRKY.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRKY

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein kinase Y-linked
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43930
Immunogen:
The immunogen for anti-PRKY antibody: synthetic peptide directed towards the N terminal of human PRKY. Synthetic peptide located within the following region: MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD.
GeneID:
5616
Application WB
Background This gene is similar toThe protein kise, X-linked gene inThe pseudoautosomal region ofThe X chromosome.The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense-mediated decay (NMD) and unlikely to express a protein. Abnormal recombition betweenThis gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [provided by RefSeq, Jul 2010].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRKY (2 products)

Catalog No. Species Pres. Purity   Source  

PRKY

PRKY Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PRKY

PRKY Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PRKY (2 products)

Catalog No. Species Pres. Purity   Source  

PRKY 293T Cell Transient Overexpression Lysate(Denatured)

PRKY 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Protein kinase Y linked Lysate

Western Blot: Protein kinase Y linked Lysate [NBL1-14788] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PRKY
  Novus Biologicals Inc.
  • LinkedIn