TA342162 PSMA5 antibody

Rabbit polyclonal Anti-PSMA5 Antibody

See related secondary antibodies

Search for all "PSMA5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PSMA5

Product Description for PSMA5

Rabbit anti Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PSMA5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PSMA5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Macropain zeta chain, Multicatalytic endopeptidase complex zeta chain, Proteasome 20S alpha 5, Proteasome subunit alpha type-5, Proteasome zeta chain
Presentation Purified
Reactivity Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P28066
Immunogen:
The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the middle region of human PSMA5. Synthetic peptide located within the following region: FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK.
GeneID:
5686
Application WB
Background The proteasome is a multicatalytic proteise complex with a highly ordered ring-shaped 20S core structure.The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome,The immunoproteasome, isThe processing of class I MHC peptides.This gene encodes a member ofThe peptidase T1A family, that is a 20S core alpha subunit. Multiple altertively spliced transcript variants encoding two distinct isoforms have been found forThis gene. [provided by RefSeq, Dec 2010].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PSMA5 (8 products)

Catalog No. Species Pres. Purity   Source  

PSMA5

PSMA5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PSMA5 (1-241, His-tag)

PSMA5 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €820.00
  OriGene Technologies GmbH

PSMA5 (1-241, His-tag)

PSMA5 Human Purified > 90 % by SDS - PAGE E. coli
10 µg / €320.00
  OriGene Technologies GmbH

PSMA5

PSMA5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PSMA5

PSMA5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PSMA5

PSMA5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PSMA5

PSMA5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PSMA5

PSMA5 Human
  Abnova Taiwan Corp.
  • LinkedIn