TA342182 PTX3 antibody

Rabbit polyclonal Anti-PTX3 Antibody

See related secondary antibodies

Search for all "PTX3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat PTX3

Product Description for PTX3

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat PTX3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PTX3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pentaxin-related protein PTX3, Pentraxin-related protein PTX3, TNF alpha-induced protein 5, TNFAIP5, TSG-14, TSG14, Tumor necrosis factor alpha-induced protein 5, Tumor necrosis factor-inducible gene 14 protein
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P26022
Immunogen:
The immunogen for anti-PTX3 antibody: synthetic peptide directed towards the N terminal of human PTX3. Synthetic peptide located within the following region: MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACG.
GeneID:
5806
Application WB
Background Plays a role inThe regulation of inte resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PTX3 (7 products)

Catalog No. Species Pres. Purity   Source  

PTX3

PTX3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PTX3 (18-381, His-tag)

PTX3 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

PTX3 (18-381, His-tag)

PTX3 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

PTX3

PTX3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTX3

PTX3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTX3

PTX3 Human
  Abnova Taiwan Corp.

PTX3

Western Blot: Pentraxin 3 Protein [NBC1-26376] Protein
  Novus Biologicals Inc.

Positive controls for PTX3 (1 products)

Catalog No. Species Pres. Purity   Source  

PTX3 overexpression lysate

PTX3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn