TA342205 SH3BP2 antibody

Rabbit polyclonal Anti-SH3BP2 Antibody

See related secondary antibodies

Search for all "SH3BP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat SH3BP2

TA342205

More Views

  • TA342205
  • TA342205

Product Description for SH3BP2

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat SH3BP2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SH3BP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3BP-2, 3BP2, SH3 domain-binding protein 2, SH3BP-2
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78314
Immunogen:
The immunogen for anti-SH3BP2 antibody: synthetic peptide directed towards the middle region of human SH3BP2. Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ.
GeneID:
6452
Application WB
IHC
Background The protein encoded byThis gene has an N-termil pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-termil SH2 domain.The protein binds toThe SH3 domains of several proteins includingThe ABL1 and SYK protein tyrosine kises , and functions as a cytoplasmic adaptor protein to positively regulate transcriptiol activity in T, tural killer (NK), and basophilic cells. Mutations inThis gene result in cherubism. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2009].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SH3BP2 (4 products)

Catalog No. Species Pres. Purity   Source  

SH3BP2 (transcript variant 1)

SH3BP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SH3BP2 (transcript variant 2)

SH3BP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SH3BP2

SH3BP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SH3BP2

SH3BP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SH3BP2 (3 products)

Catalog No. Species Pres. Purity   Source  

SH3BP2 Lysate

Western Blot: SH3BP2 Lysate [NBL1-15927] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SH3BP1
  Novus Biologicals Inc.

SH3BP2 overexpression lysate

SH3BP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SH3BP2 overexpression lysate

SH3BP2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn