TA342209 Endophilin-A3 (Center) antibody

Rabbit polyclonal Anti-Sh3gl3 Antibody

See related secondary antibodies

Search for all "Endophilin-A3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse Endophilin-A3

Product Description for Endophilin-A3

Rabbit anti Human, Mouse Endophilin-A3.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Endophilin-A3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CNSA3, EEN-B2, Endophilin-3, SH3 domain protein 2C, SH3 domain-containing GRB2-like protein 3, SH3D2C, SH3GL3
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight Sh3gl3: 38 kDa
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q62421
Immunogen:
Synthetic peptide corresponding to a middle region of mouse Endophilin-A3
AA Sequence:
IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK
GeneID:
20408
Property Center
Application Western blotting (1 µg/ml).
Background Sh3gl3 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.
General Readings Hughes AC, Errington R, Fricker-Gates R, Jones L. Endophilin A3 forms filamentous structures that colocalise with microtubules but not with actin filaments. Brain Res Mol Brain Res. 2004 Sep 28;128(2):182-92.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Mouse, human.

Accessory Products

  • LinkedIn